PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01888.1.g00090.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 232aa    MW: 25673.3 Da    PI: 8.7139
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01888.1.g00090.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.41.4e-1973127256
                                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                     rk+ +++k+q  +Le+ F+++++++ ++++ LA++lgL  rqV vWFqNrRa+ k
  Zpz_sc01888.1.g00090.1.sm.mkhc  73 RKKLRLSKDQSAVLEDSFREHPTLNPRQKAALAQQLGLRPRQVEVWFQNRRARTK 127
                                     788899***********************************************98 PP

2HD-ZIP_I/II129.31.5e-4173162191
                     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeener 79 
                                     +kk+rlsk+q+++LE+sF+e+ +L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+r
  Zpz_sc01888.1.g00090.1.sm.mkhc  73 RKKLRLSKDQSAVLEDSFREHPTLNPRQKAALAQQLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCETLTEENRR 151
                                     69***************************************************************************** PP

                     HD-ZIP_I/II  80 LekeveeLreel 91 
                                     L+kev+eLr +l
  Zpz_sc01888.1.g00090.1.sm.mkhc 152 LQKEVQELR-AL 162
                                     ********9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.27E-1964130IPR009057Homeodomain-like
PROSITE profilePS5007117.31369129IPR001356Homeobox domain
SMARTSM003897.4E-1871133IPR001356Homeobox domain
PfamPF000466.5E-1773127IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.2E-1973127IPR009057Homeodomain-like
CDDcd000867.88E-1773130No hitNo description
PRINTSPR000314.0E-6100109IPR000047Helix-turn-helix motif
PROSITE patternPS000270104127IPR017970Homeobox, conserved site
PRINTSPR000314.0E-6109125IPR000047Helix-turn-helix motif
SMARTSM003404.4E-25129172IPR003106Leucine zipper, homeobox-associated
PfamPF021832.1E-11129163IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MMERADDLGL SLSLSSSLAP RTHHHVAMLL RSPEKRFLEM PLLPAKRSEV AAEEGLRGGS  60
DEEDGGCGID GSRKKLRLSK DQSAVLEDSF REHPTLNPRQ KAALAQQLGL RPRQVEVWFQ  120
NRRARTKLKQ TEVDCEFLKR CCETLTEENR RLQKEVQELR ALKLVSPHLY MHMSPPTTLT  180
MCPSCERVSN ANSADRRAGA GSVDASPAAA GVDGAICHRP IAVRPQQSLA SS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17177SRKKLRL
2121129RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9749801e-167EU974980.1 Zea mays clone 462177 homeobox-leucine zipper protein ATHB-4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976428.11e-131PREDICTED: homeobox-leucine zipper protein HOX17-like
SwissprotQ0JB921e-112HOX17_ORYSJ; Homeobox-leucine zipper protein HOX17
TrEMBLK3Y9R61e-131K3Y9R6_SETIT; Uncharacterized protein
STRINGSi010958m1e-131(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25873889
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.16e-75homeobox protein 2